Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) consists of one domain of this fold |
Family c.55.3.1: Ribonuclease H [53099] (3 proteins) |
Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (65 PDB entries) |
Domain d1jlga1: 1jlg A:430-539 [66848] Other proteins in same PDB: d1jlga2, d1jlgb_ complexed with uc1; mutant |
PDB Entry: 1jlg (more details), 2.6 Å
SCOP Domain Sequences for d1jlga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jlga1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1} ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah
Timeline for d1jlga1: