SCOP 1.59: Domain d1jl9a_: 1jl9 A:

Lineage for d1jl9a_ (1jl9 A:)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)

4. Superfamily g.3.11: EGF/Laminin [57196] (6 families)

5. Family g.3.11.1: EGF-type module [57197] (17 proteins)

6. Protein Epidermal growth factor, EGF [57215] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69939] (1 PDB entry)

8. Domain d1jl9a_: 1jl9 A: [66831]

Details for d1jl9a_

PDB Entry: 1jl9, 3 Å

PDB Description: Crystal Structure of Human Epidermal Growth Factor

SCOP Domain Sequences for d1jl9a_:

Sequence; same for both SEQRES and ATOM records:

>d1jl9a_ g.3.11.1 (A:) Epidermal growth factor, EGF {Human (Homo sapiens)}
cplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdl

Timeline for d1jl9a_:

• d1jl9a_ is new in SCOP 1.59
  
• d1jl9a_ appears in SCOP 1.61
  
• d1jl9a_ appears in the current release, SCOPe 2.08