SCOP 1.59: Domain d1jl2d_: 1jl2 D:

Lineage for d1jl2d_ (1jl2 D:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein RNase H (RNase HI) [53100] (3 species)

7. Species Chimeric (Escherichia coli/Thermus thermophilus) [69532] (1 PDB entry)

8. Domain d1jl2d_: 1jl2 D: [66825]

Details for d1jl2d_

PDB Entry: 1jl2, 1.76 Å

PDB Description: crystal structure of tceo rnase h-a chimera combining the folding core from t. thermophilus rnase h and the remaining region of e. coli rnase h

SCOP Domain Sequences for d1jl2d_:

Sequence, based on SEQRES records:

>d1jl2d_ c.55.3.1 (D:) RNase H (RNase HI) {Chimeric (Escherichia coli/Thermus thermophilus)}
kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalkep
aevdlytdshylkkaftegwlegwrkrgwrtaegkpvknrdlwealllamaphrvrfhfv
kghaghpeneradelaraaamnptledtgyq

Sequence, based on observed residues (ATOM records):

>d1jl2d_ c.55.3.1 (D:) RNase H (RNase HI) {Chimeric (Escherichia coli/Thermus thermophilus)}
kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalkep
aevdlytdshylkkaftegwlegwrtaegkpvknrdlwealllamaphrvrfhfvkghag
hpeneradelaraaamnptledtgyq

Timeline for d1jl2d_:

• d1jl2d_ is new in SCOP 1.59
  
• d1jl2d_ appears in SCOP 1.61
  
• d1jl2d_ appears in the current release, SCOPe 2.08