| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
| Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
| Protein RNase H (RNase HI) [53100] (4 species) |
| Species synthetic, Escherichia coli/Thermus thermophilus chimera [69532] (1 PDB entry) |
| Domain d1jl2a_: 1jl2 A: [66822] |
PDB Entry: 1jl2 (more details), 1.76 Å
SCOPe Domain Sequences for d1jl2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jl2a_ c.55.3.1 (A:) RNase H (RNase HI) {synthetic, Escherichia coli/Thermus thermophilus chimera}
kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalkep
aevdlytdshylkkaftegwlegwrkrgwrtaegkpvknrdlwealllamaphrvrfhfv
kghaghpeneradelaraaamnptledtgy
Timeline for d1jl2a_: