Lineage for d1jkxd_ (1jkx D:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 839503Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 839504Superfamily c.65.1: Formyltransferase [53328] (1 family) (S)
  5. 839505Family c.65.1.1: Formyltransferase [53329] (4 proteins)
  6. 839512Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)
  7. 839513Species Escherichia coli [TaxId:562] [53331] (9 PDB entries)
  8. 839517Domain d1jkxd_: 1jkx D: [66816]
    complexed with 138

Details for d1jkxd_

PDB Entry: 1jkx (more details), 1.6 Å

PDB Description: unexpected formation of an epoxide-derived multisubstrate adduct inhibitor on the active site of gar transformylase
PDB Compounds: (D:) phosphoribosylglycinamide formyltransferase

SCOP Domain Sequences for d1jkxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkxd_ c.65.1.1 (D:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
iswfadgrlkmhenaawldgqrlppqgya

SCOP Domain Coordinates for d1jkxd_:

Click to download the PDB-style file with coordinates for d1jkxd_.
(The format of our PDB-style files is described here.)

Timeline for d1jkxd_: