SCOP 1.73: Domain d1jkxa_: 1jkx A:

Lineage for d1jkxa_ (1jkx A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.65: Formyltransferase [53327] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest

4. Superfamily c.65.1: Formyltransferase [53328] (1 family)

5. Family c.65.1.1: Formyltransferase [53329] (4 proteins)

6. Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)

7. Species Escherichia coli [TaxId:562] [53331] (9 PDB entries)

8. Domain d1jkxa_: 1jkx A: [66813]

Details for d1jkxa_

PDB Entry: 1jkx, 1.6 Å

PDB Description: unexpected formation of an epoxide-derived multisubstrate adduct inhibitor on the active site of gar transformylase

PDB Compounds: (A:) phosphoribosylglycinamide formyltransferase

SCOP Domain Sequences for d1jkxa_:

Sequence; same for both SEQRES and ATOM records:

>d1jkxa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
iswfadgrlkmhenaawldgqrlppqgya

Timeline for d1jkxa_:

• d1jkxa_ first appeared in SCOP 1.59
  
• d1jkxa_ appears in SCOP 1.71
  
• d1jkxa_ appears in SCOP 1.75
  
• d1jkxa_ appears in the current release, SCOPe 2.08