Lineage for d1jkna1 (1jkn A:6-165)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971526Protein Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) [64367] (3 species)
  7. 2971531Species Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId:3871] [64368] (2 PDB entries)
  8. 2971532Domain d1jkna1: 1jkn A:6-165 [66808]
    Other proteins in same PDB: d1jkna2
    complexed with atp

Details for d1jkna1

PDB Entry: 1jkn (more details)

PDB Description: solution structure of the nudix enzyme diadenosine tetraphosphate hydrolase from lupinus angustifolius complexed with atp
PDB Compounds: (A:) diadenosine 5',5'''-p1,p4-tetraphosphate hydrolase

SCOPe Domain Sequences for d1jkna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkna1 d.113.1.1 (A:6-165) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]}
mdsppegyrrnvgiclmnndkkifaasrldipdawqmpqggidegedprnaairelreet
gvtsaeviaevpywltydfppkvreklniqwgsdwkgqaqkwflfkftgqdqeinllgdg
sekpefgewswvtpeqlidltvefkkpvykevlsvfaphl

SCOPe Domain Coordinates for d1jkna1:

Click to download the PDB-style file with coordinates for d1jkna1.
(The format of our PDB-style files is described here.)

Timeline for d1jkna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jkna2