SCOPe 2.02: Domain d1jkje2: 1jkj E:1-238

Lineage for d1jkje2 (1jkj E:1-238)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families)

5. Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)

6. Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)

7. Species Escherichia coli [TaxId:562] [56083] (11 PDB entries)

8. Domain d1jkje2: 1jkj E:1-238 [66807]
   Other proteins in same PDB: d1jkja1, d1jkja2, d1jkjb1, d1jkjd1, d1jkjd2, d1jkje1
   complexed with coa, gol, po4, so4

Details for d1jkje2

PDB Entry: 1jkj, 2.35 Å

PDB Description: E. coli SCS

PDB Compounds: (E:) succinyl-CoA synthetase beta subunit

SCOPe Domain Sequences for d1jkje2:

Sequence; same for both SEQRES and ATOM records:

>d1jkje2 d.142.1.4 (E:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe

Timeline for d1jkje2:

• d1jkje2 first appeared in SCOP 1.59
  
• d1jkje2 appears in SCOPe 2.01
  
• d1jkje2 appears in SCOPe 2.03
  
• d1jkje2 appears in the current release, SCOPe 2.08