SCOP 1.75: Domain d1jkje2: 1jkj E:1-238

Lineage for d1jkje2 (1jkj E:1-238)

Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.142: ATP-grasp [56058] (2 superfamilies)
Consists of two subdomains with different alpha+beta folds
shares functional and structural similarities with the PIPK and protein kinase superfamilies
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families)
Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)
Species Escherichia coli [TaxId:562] [56083] (11 PDB entries)
Domain d1jkje2: 1jkj E:1-238 [66807]
Other proteins in same PDB: d1jkja1, d1jkja2, d1jkjb1, d1jkjd1, d1jkjd2, d1jkje1
complexed with coa, gol, po4, so4

Details for d1jkje2

PDB Entry: 1jkj (more details), 2.35 Å

PDB Description: E. coli SCS

PDB Compounds: (E:) succinyl-CoA synthetase beta subunit

SCOP Domain Sequences for d1jkje2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkje2 d.142.1.4 (E:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe

SCOP Domain Coordinates for d1jkje2:

Click to download the PDB-style file with coordinates for d1jkje2.
(The format of our PDB-style files is described here.)

Timeline for d1jkje2: