Lineage for d1jkjb1 (1jkj B:239-388)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120208Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 120347Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) (S)
  5. 120348Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (2 proteins)
  6. 120366Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)
  7. 120367Species Escherichia coli [TaxId:562] [52216] (6 PDB entries)
  8. 120368Domain d1jkjb1: 1jkj B:239-388 [66802]
    Other proteins in same PDB: d1jkja1, d1jkja2, d1jkjb2, d1jkjd1, d1jkjd2, d1jkje2

Details for d1jkjb1

PDB Entry: 1jkj (more details), 2.35 Å

PDB Description: E. coli SCS

SCOP Domain Sequences for d1jkjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkjb1 c.23.4.1 (B:239-388) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli}
dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv
teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga
kkladsglniiaakgltdaaqqvvaavegk

SCOP Domain Coordinates for d1jkjb1:

Click to download the PDB-style file with coordinates for d1jkjb1.
(The format of our PDB-style files is described here.)

Timeline for d1jkjb1: