SCOPe 2.08: Domain d1jkgb1: 1jkg B:371-555

Lineage for d1jkgb1 (1jkg B:371-555)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.2: NTF2-like [54431] (6 proteins)

6. Protein NTF2-like domain of Tip associating protein, TAP [69677] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69678] (2 PDB entries)

8. Domain d1jkgb1: 1jkg B:371-555 [66796]
   Other proteins in same PDB: d1jkga_, d1jkgb2
   has additional insertions and/or extensions that are not grouped together

Details for d1jkgb1

PDB Entry: 1jkg, 1.9 Å

PDB Description: Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain of TAP-p15 mRNA nuclear export factor

PDB Compounds: (B:) tap

SCOPe Domain Sequences for d1jkgb1:

Sequence, based on SEQRES records:

>d1jkgb1 d.17.4.2 (B:371-555) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]}
ppckgsyfgtenlkslvlhflqqyyaiydsgdrqglldayhdgaccslsipfipqnpars
slaeyfkdsrnvkklkdptlrfrllkhtrlnvvaflnelpktqhdvnsfvvdisaqtstl
lcfsvngvfkevdgksrdslraftrtfiavpasnsglcivndelfvrnasseeiqrafam
paptp

Sequence, based on observed residues (ATOM records):

>d1jkgb1 d.17.4.2 (B:371-555) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]}
ppckgsyfgtenlkslvlhflqqyyaiydsgdrqglldayhdgaccslsipfisslaeyf
kdsrnvkklkdptlrfrllkhtrlnvvaflnelpktqhdvnsfvvdisaqtstllcfsvn
gvfkevdgksrdslraftrtfiavpasnsglcivndelfvrnasseeiqrafampaptp

Timeline for d1jkgb1:

• d1jkgb1 first appeared in SCOP 1.59, called d1jkgb_
  
• d1jkgb1 appears in SCOPe 2.07