SCOP 1.61: Domain d1jjuc_: 1jju C:

Lineage for d1jjuc_ (1jju C:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies)

4. Superfamily a.137.9: Quinohemoprotein amine dehydrogenase C chain [69131] (1 family)

5. Family a.137.9.1: Quinohemoprotein amine dehydrogenase C chain [69132] (1 protein)

6. Protein Quinohemoprotein amine dehydrogenase C chain [69133] (2 species)

7. Species Paracoccus denitrificans [TaxId:266] [69134] (1 PDB entry)

8. Domain d1jjuc_: 1jju C: [66780]
   Other proteins in same PDB: d1jjua1, d1jjua2, d1jjua3, d1jjua4, d1jjua5, d1jjub_

Details for d1jjuc_

PDB Entry: 1jju, 2.05 Å

PDB Description: Structure of a Quinohemoprotein Amine Dehydrogenase with a Unique Redox Cofactor and Highly Unusual Crosslinking

SCOP Domain Sequences for d1jjuc_:

Sequence; same for both SEQRES and ATOM records:

>d1jjuc_ a.137.9.1 (C:) Quinohemoprotein amine dehydrogenase C chain {Paracoccus denitrificans}
mnalvgcttsfdpgwevdafgavsnlcqpmeadlygcadpcwxpaqvadtlntypnwsag
addvmqdwrklqsvfpetk

Timeline for d1jjuc_:

• d1jjuc_ first appeared in SCOP 1.59
  
• d1jjuc_ appears in SCOP 1.63
  
• d1jjuc_ appears in the current release, SCOPe 2.08