Lineage for d1jjua5 (1jju A:166-273)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 806367Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 806700Superfamily b.61.4: Quinohemoprotein amine dehydrogenase A chain, domain 3 [69298] (1 family) (S)
  5. 806701Family b.61.4.1: Quinohemoprotein amine dehydrogenase A chain, domain 3 [69299] (1 protein)
  6. 806702Protein Quinohemoprotein amine dehydrogenase A chain, domain 3 [69300] (2 species)
  7. 806703Species Paracoccus denitrificans [TaxId:266] [69301] (2 PDB entries)
  8. 806705Domain d1jjua5: 1jju A:166-273 [66778]
    Other proteins in same PDB: d1jjua1, d1jjua2, d1jjua3, d1jjua4, d1jjub_, d1jjuc_
    complexed with hem, na, tbu, trq

Details for d1jjua5

PDB Entry: 1jju (more details), 2.05 Å

PDB Description: Structure of a Quinohemoprotein Amine Dehydrogenase with a Unique Redox Cofactor and Highly Unusual Crosslinking
PDB Compounds: (A:) quinohemoprotein amine dehydrogenase

SCOP Domain Sequences for d1jjua5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjua5 b.61.4.1 (A:166-273) Quinohemoprotein amine dehydrogenase A chain, domain 3 {Paracoccus denitrificans [TaxId: 266]}
pdayaddasgayvlagrqpgrgdytgrlvlkkagedyevtmtldfadgsrsfsgtgrilg
agewratlsdgtvtirqifalqdgrfsgrwhdadsdviggrlaavkad

SCOP Domain Coordinates for d1jjua5:

Click to download the PDB-style file with coordinates for d1jjua5.
(The format of our PDB-style files is described here.)

Timeline for d1jjua5: