Lineage for d1jjua5 (1jju A:166-273)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.61: Streptavidin-like [50875] (5 superfamilies) 
Superfamily b.61.4: Quinohemoprotein amine dehydrogenase A chain, domain 3 [69298] (1 family) 
Family b.61.4.1: Quinohemoprotein amine dehydrogenase A chain, domain 3 [69299] (1 protein) Protein Quinohemoprotein amine dehydrogenase A chain, domain 3 [69300] (2 species) 
Species Paracoccus denitrificans [TaxId:266] [69301] (1 PDB entry) 
Domain d1jjua5: 1jju A:166-273 [66778]
Other proteins in same PDB: d1jjua1, d1jjua2, d1jjua3, d1jjua4, d1jjub_, d1jjuc_
Details for d1jjua5
PDB Entry: 1jju (more details), 2.05 Å
PDB Description: Structure of a Quinohemoprotein Amine Dehydrogenase with a Unique Redox Cofactor and Highly Unusual Crosslinking
SCOP Domain Sequences for d1jjua5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jjua5 b.61.4.1 (A:166-273) Quinohemoprotein amine dehydrogenase A chain, domain 3 {Paracoccus denitrificans}
pdayaddasgayvlagrqpgrgdytgrlvlkkagedyevtmtldfadgsrsfsgtgrilg
agewratlsdgtvtirqifalqdgrfsgrwhdadsdviggrlaavkad
SCOP Domain Coordinates for d1jjua5:
Click to download the PDB-style file with coordinates for d1jjua5.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jjua5:
- d1jjua5 first appeared in SCOP 1.59
- d1jjua5 appears in SCOP 1.63
- d1jjua5 appears in the current release, SCOPe 2.08
 View in 3DDomains from same chain: (mouse over for more information) d1jjua1, d1jjua2, d1jjua3, d1jjua4 |
