Lineage for d1jjua4 (1jju A:352-489)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 291481Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 291841Family b.1.18.14: Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [81294] (1 protein)
  6. 291842Protein Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [69176] (2 species)
    duplication: tandem repeat of two Ig-like domains
  7. 291843Species Paracoccus denitrificans [TaxId:266] [69177] (1 PDB entry)
  8. 291845Domain d1jjua4: 1jju A:352-489 [66777]
    Other proteins in same PDB: d1jjua1, d1jjua2, d1jjua5, d1jjub_, d1jjuc_
    complexed with hem, na, tbu, trq

Details for d1jjua4

PDB Entry: 1jju (more details), 2.05 Å

PDB Description: Structure of a Quinohemoprotein Amine Dehydrogenase with a Unique Redox Cofactor and Highly Unusual Crosslinking

SCOP Domain Sequences for d1jjua4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjua4 b.1.18.14 (A:352-489) Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 {Paracoccus denitrificans}
rpdrisivpdltiariggnggpipkvpaqfeamgwlngpdgqpgtgddialgafpaswat
dnfdeeaekmqdakyagsiddtglftpaeagpnperpmqtnnagnlkviatvdaegepls
aeahlyatvqrfvdapir

SCOP Domain Coordinates for d1jjua4:

Click to download the PDB-style file with coordinates for d1jjua4.
(The format of our PDB-style files is described here.)

Timeline for d1jjua4: