![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (17 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.14: Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [81294] (1 protein) |
![]() | Protein Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [69176] (2 species) duplication: tandem repeat of two Ig-like domains |
![]() | Species Paracoccus denitrificans [TaxId:266] [69177] (1 PDB entry) |
![]() | Domain d1jjua4: 1jju A:352-489 [66777] Other proteins in same PDB: d1jjua1, d1jjua2, d1jjua5, d1jjub_, d1jjuc_ complexed with hem, na, tbu, trq |
PDB Entry: 1jju (more details), 2.05 Å
SCOP Domain Sequences for d1jjua4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jjua4 b.1.18.14 (A:352-489) Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 {Paracoccus denitrificans} rpdrisivpdltiariggnggpipkvpaqfeamgwlngpdgqpgtgddialgafpaswat dnfdeeaekmqdakyagsiddtglftpaeagpnperpmqtnnagnlkviatvdaegepls aeahlyatvqrfvdapir
Timeline for d1jjua4:
![]() Domains from same chain: (mouse over for more information) d1jjua1, d1jjua2, d1jjua3, d1jjua5 |