Lineage for d1jjua4 (1jju A:352-489)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160911Family b.1.1.6: Internalin Ig-like domain [68902] (5 proteins)
  6. 160927Protein Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [69176] (2 species)
  7. 160928Species Paracoccus denitrificans [TaxId:266] [69177] (1 PDB entry)
  8. 160930Domain d1jjua4: 1jju A:352-489 [66777]
    Other proteins in same PDB: d1jjua1, d1jjua2, d1jjua5, d1jjub_, d1jjuc_

Details for d1jjua4

PDB Entry: 1jju (more details), 2.05 Å

PDB Description: Structure of a Quinohemoprotein Amine Dehydrogenase with a Unique Redox Cofactor and Highly Unusual Crosslinking

SCOP Domain Sequences for d1jjua4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjua4 b.1.1.6 (A:352-489) Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 {Paracoccus denitrificans}
rpdrisivpdltiariggnggpipkvpaqfeamgwlngpdgqpgtgddialgafpaswat
dnfdeeaekmqdakyagsiddtglftpaeagpnperpmqtnnagnlkviatvdaegepls
aeahlyatvqrfvdapir

SCOP Domain Coordinates for d1jjua4:

Click to download the PDB-style file with coordinates for d1jjua4.
(The format of our PDB-style files is described here.)

Timeline for d1jjua4: