Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.6: Internalin Ig-like domain [68902] (5 proteins) |
Protein Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [69176] (2 species) |
Species Paracoccus denitrificans [TaxId:266] [69177] (1 PDB entry) |
Domain d1jjua4: 1jju A:352-489 [66777] Other proteins in same PDB: d1jjua1, d1jjua2, d1jjua5, d1jjub_, d1jjuc_ |
PDB Entry: 1jju (more details), 2.05 Å
SCOP Domain Sequences for d1jjua4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jjua4 b.1.1.6 (A:352-489) Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 {Paracoccus denitrificans} rpdrisivpdltiariggnggpipkvpaqfeamgwlngpdgqpgtgddialgafpaswat dnfdeeaekmqdakyagsiddtglftpaeagpnperpmqtnnagnlkviatvdaegepls aeahlyatvqrfvdapir
Timeline for d1jjua4:
View in 3D Domains from same chain: (mouse over for more information) d1jjua1, d1jjua2, d1jjua3, d1jjua5 |