Lineage for d1jjua4 (1jju A:352-489)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765875Family b.1.18.14: Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [81294] (1 protein)
  6. 2765876Protein Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [69176] (2 species)
    duplication: tandem repeat of two Ig-like domains
  7. 2765877Species Paracoccus denitrificans [TaxId:266] [69177] (2 PDB entries)
  8. 2765881Domain d1jjua4: 1jju A:352-489 [66777]
    Other proteins in same PDB: d1jjua1, d1jjua2, d1jjua5, d1jjub_, d1jjuc_
    complexed with hem, na, tbu

Details for d1jjua4

PDB Entry: 1jju (more details), 2.05 Å

PDB Description: Structure of a Quinohemoprotein Amine Dehydrogenase with a Unique Redox Cofactor and Highly Unusual Crosslinking
PDB Compounds: (A:) quinohemoprotein amine dehydrogenase

SCOPe Domain Sequences for d1jjua4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjua4 b.1.18.14 (A:352-489) Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 {Paracoccus denitrificans [TaxId: 266]}
rpdrisivpdltiariggnggpipkvpaqfeamgwlngpdgqpgtgddialgafpaswat
dnfdeeaekmqdakyagsiddtglftpaeagpnperpmqtnnagnlkviatvdaegepls
aeahlyatvqrfvdapir

SCOPe Domain Coordinates for d1jjua4:

Click to download the PDB-style file with coordinates for d1jjua4.
(The format of our PDB-style files is described here.)

Timeline for d1jjua4: