SCOPe 2.08: Domain d1jjua4: 1jju A:352-489

Lineage for d1jjua4 (1jju A:352-489)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.14: Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [81294] (1 protein)

6. Protein Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [69176] (2 species)
   duplication: tandem repeat of two Ig-like domains

7. Species Paracoccus denitrificans [TaxId:266] [69177] (2 PDB entries)

8. Domain d1jjua4: 1jju A:352-489 [66777]
   Other proteins in same PDB: d1jjua1, d1jjua2, d1jjua5, d1jjub_, d1jjuc_
   complexed with hem, na, tbu

Details for d1jjua4

PDB Entry: 1jju, 2.05 Å

PDB Description: Structure of a Quinohemoprotein Amine Dehydrogenase with a Unique Redox Cofactor and Highly Unusual Crosslinking

PDB Compounds: (A:) quinohemoprotein amine dehydrogenase

SCOPe Domain Sequences for d1jjua4:

Sequence; same for both SEQRES and ATOM records:

>d1jjua4 b.1.18.14 (A:352-489) Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 {Paracoccus denitrificans [TaxId: 266]}
rpdrisivpdltiariggnggpipkvpaqfeamgwlngpdgqpgtgddialgafpaswat
dnfdeeaekmqdakyagsiddtglftpaeagpnperpmqtnnagnlkviatvdaegepls
aeahlyatvqrfvdapir

Timeline for d1jjua4:

• d1jjua4 first appeared in SCOP 1.59
  
• d1jjua4 appears in SCOPe 2.07