Lineage for d1jjua1 (1jju A:1-85)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760650Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 760651Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 761104Family a.3.1.7: Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 [68956] (1 protein)
  6. 761105Protein Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 [68957] (2 species)
    duplication: tandem repeat of two cytochrome c-like domains
  7. 761106Species Paracoccus denitrificans [TaxId:266] [68958] (2 PDB entries)
  8. 761109Domain d1jjua1: 1jju A:1-85 [66774]
    Other proteins in same PDB: d1jjua3, d1jjua4, d1jjua5, d1jjub_, d1jjuc_

Details for d1jjua1

PDB Entry: 1jju (more details), 2.05 Å

PDB Description: Structure of a Quinohemoprotein Amine Dehydrogenase with a Unique Redox Cofactor and Highly Unusual Crosslinking
PDB Compounds: (A:) quinohemoprotein amine dehydrogenase

SCOP Domain Sequences for d1jjua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjua1 a.3.1.7 (A:1-85) Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 {Paracoccus denitrificans [TaxId: 266]}
vtgeevlqnacaachvqhedgrweridaarktpegwdmtvtrmmrnhgvalepeeraaiv
rhlsdtrglslaeteerryilerep

SCOP Domain Coordinates for d1jjua1:

Click to download the PDB-style file with coordinates for d1jjua1.
(The format of our PDB-style files is described here.)

Timeline for d1jjua1: