SCOP 1.61: Domain d1jjua1: 1jju A:1-85

Lineage for d1jjua1 (1jju A:1-85)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)

4. Superfamily a.3.1: Cytochrome c [46626] (7 families)

5. Family a.3.1.7: Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 [68956] (1 protein)

6. Protein Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 [68957] (2 species)

7. Species Paracoccus denitrificans [TaxId:266] [68958] (1 PDB entry)

8. Domain d1jjua1: 1jju A:1-85 [66774]
   Other proteins in same PDB: d1jjua3, d1jjua4, d1jjua5, d1jjub_, d1jjuc_

Details for d1jjua1

PDB Entry: 1jju, 2.05 Å

PDB Description: Structure of a Quinohemoprotein Amine Dehydrogenase with a Unique Redox Cofactor and Highly Unusual Crosslinking

SCOP Domain Sequences for d1jjua1:

Sequence; same for both SEQRES and ATOM records:

>d1jjua1 a.3.1.7 (A:1-85) Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 {Paracoccus denitrificans}
vtgeevlqnacaachvqhedgrweridaarktpegwdmtvtrmmrnhgvalepeeraaiv
rhlsdtrglslaeteerryilerep

Timeline for d1jjua1:

• d1jjua1 first appeared in SCOP 1.59
  
• d1jjua1 appears in SCOP 1.63
  
• d1jjua1 appears in the current release, SCOPe 2.08