![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.40: OB-fold [50198] (8 superfamilies) |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) ![]() |
![]() | Family b.40.4.4: Myf domain [50277] (3 proteins) |
![]() | Protein Domain B2 of PheRS-beta, PheT [50278] (1 species) |
![]() | Species Thermus thermophilus (Thermus aquaticus) [50279] (5 PDB entries) |
![]() | Domain d1jjcb3: 1jjc B:39-151 [66761] Other proteins in same PDB: d1jjca_, d1jjcb1, d1jjcb2, d1jjcb4, d1jjcb5, d1jjcb6 |
PDB Entry: 1jjc (more details), 2.6 Å
SCOP Domain Sequences for d1jjcb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jjcb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)} fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp
Timeline for d1jjcb3: