SCOPe 2.08: Domain d1jjcb3: 1jjc B:39-151

Lineage for d1jjcb3 (1jjc B:39-151)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.4: Myf domain [50277] (7 proteins)

6. Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)

7. Species Thermus thermophilus [TaxId:274] [50279] (12 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d1jjcb3: 1jjc B:39-151 [66761]
   Other proteins in same PDB: d1jjca_, d1jjcb1, d1jjcb2, d1jjcb4, d1jjcb5, d1jjcb6
   protein/RNA complex; complexed with fa5, mn, so4

Details for d1jjcb3

PDB Entry: 1jjc, 2.6 Å

PDB Description: Crystal structure at 2.6A resolution of phenylalanyl-tRNA synthetase complexed with phenylalanyl-adenylate in the presence of manganese

PDB Compounds: (B:) phenylalanyl-tRNA synthetase beta chain

SCOPe Domain Sequences for d1jjcb3:

Sequence; same for both SEQRES and ATOM records:

>d1jjcb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

Timeline for d1jjcb3:

• d1jjcb3 first appeared in SCOP 1.59
  
• d1jjcb3 appears in SCOPe 2.07