Class a: All alpha proteins [46456] (179 folds) |
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
Superfamily a.6.1: Putative DNA-binding domain [46955] (7 families) |
Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein) dulication: contains two such domains related by pseudo dyad |
Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species) |
Species Thermus thermophilus (Thermus aquaticus) [46958] (5 PDB entries) |
Domain d1jjcb1: 1jjc B:1-38,B:152-190 [66759] Other proteins in same PDB: d1jjca_, d1jjcb3, d1jjcb4, d1jjcb5, d1jjcb6 |
PDB Entry: 1jjc (more details), 2.6 Å
SCOP Domain Sequences for d1jjcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jjcb1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)} mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg lardlhalgyalvepeaa
Timeline for d1jjcb1: