Lineage for d1jiha_ (1jih A:)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 339256Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 339257Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 339520Family e.8.1.5: Lesion bypass DNA polymerase (Y-family) [64477] (2 proteins)
  6. 339530Protein DNA polymerase eta [69880] (1 species)
  7. 339531Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69881] (1 PDB entry)
  8. 339532Domain d1jiha_: 1jih A: [66740]

Details for d1jiha_

PDB Entry: 1jih (more details), 2.25 Å

PDB Description: Yeast DNA Polymerase ETA

SCOP Domain Sequences for d1jiha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jiha_ e.8.1.5 (A:) DNA polymerase eta {Baker's yeast (Saccharomyces cerevisiae)}
mskftwkeliqlgspskayesslaciahidmnaffaqveqmrcglskedpvvcvqwnsii
avsyaarkygisrmdtiqealkkcsnlipihtavfkkgedfwqyhdgcgswvqdpakqis
vedhkvslepyrresrkalkifksacdlverasidevfldlgricfnmlmfdneyeltgd
lklkdalsnireafiggnydinshlplipekikslkfegdvfnpegrdlitdwddvilal
gsqvckgirdsikdilgyttscglsstknvcklasnykkpdaqtivkndclldfldcgkf
eitsfwtlggvlgkelidvldlphensikhiretwpdnagqlkefldakvkqsdydrsts
nidplktadlaeklfklsrgryglplssrpvvksmmsnknlrgkscnsivdciswlevfc
aeltsriqdleqeynkiviprtvsislktksyevyrksgpvaykginfqshellkvgikf
vtdldikgknksyypltklsmtitnfdii

SCOP Domain Coordinates for d1jiha_:

Click to download the PDB-style file with coordinates for d1jiha_.
(The format of our PDB-style files is described here.)

Timeline for d1jiha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jihb_