Lineage for d1jhzb_ (1jhz B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127989Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 127990Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 127991Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins)
  6. 128080Protein Purine repressor (PurR), C-terminal domain [53835] (1 species)
  7. 128081Species Escherichia coli [TaxId:562] [53836] (24 PDB entries)
  8. 128095Domain d1jhzb_: 1jhz B: [66732]

Details for d1jhzb_

PDB Entry: 1jhz (more details), 2.4 Å

PDB Description: Purine Repressor Mutant Corepressor Binding Domain Structure

SCOP Domain Sequences for d1jhzb_:

Sequence, based on SEQRES records: (download)

>d1jhzb_ c.93.1.1 (B:) Purine repressor (PurR), C-terminal domain {Escherichia coli}
ksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgl
lvmcseypepllamleeyrhipmvvmdfgeakadftdavidnafeggymagrylierghr
eigvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphr
ptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslge
tafnmlldrivnkreepqsievhprlierrsvadgpfrdyrr

Sequence, based on observed residues (ATOM records): (download)

>d1jhzb_ c.93.1.1 (B:) Purine repressor (PurR), C-terminal domain {Escherichia coli}
ksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgl
lvmcseypepllamleeyrhipmvvmdfgeakadftdavidnafeggymagrylierghr
eigvipgpagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrptavfc
ggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgetafnml
ldrivnkreepqsievhprlierrsvadgpfrdyrr

SCOP Domain Coordinates for d1jhzb_:

Click to download the PDB-style file with coordinates for d1jhzb_.
(The format of our PDB-style files is described here.)

Timeline for d1jhzb_: