Lineage for d1jhna2 (1jhn A:412-458)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 108496Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 108497Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (12 families) (S)
  5. 109066Family b.29.1.12: Calnexin/calreticulin [69236] (1 protein)
  6. 109067Protein Calnexin [69237] (1 species)
  7. 109068Species Dog (Canis familiaris) [TaxId:9615] [69238] (1 PDB entry)
  8. 109070Domain d1jhna2: 1jhn A:412-458 [66721]
    Other proteins in same PDB: d1jhna3

Details for d1jhna2

PDB Entry: 1jhn (more details), 2.9 Å

PDB Description: Crystal Structure of the Lumenal Domain of Calnexin

SCOP Domain Sequences for d1jhna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jhna2 b.29.1.12 (A:412-458) Calnexin {Dog (Canis familiaris)}
lepfkmtpfsaiglelwsmtsdiffdnfivcgdrrvvddwandgwgl

SCOP Domain Coordinates for d1jhna2:

Click to download the PDB-style file with coordinates for d1jhna2.
(The format of our PDB-style files is described here.)

Timeline for d1jhna2:

  • d1jhna2 is new in SCOP 1.59
  • d1jhna2 does not appear in SCOP 1.61