Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species Anti-estradiol Fab 57-2, (mouse), kappa L chain [69137] (2 PDB entries) |
Domain d1jhkl1: 1jhk L:1-107 [66717] Other proteins in same PDB: d1jhkh2, d1jhkl2 |
PDB Entry: 1jhk (more details), 2.51 Å
SCOP Domain Sequences for d1jhkl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jhkl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-estradiol Fab 57-2, (mouse), kappa L chain} diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps rfsgsgsgtqyslkinslqpedfgtyychhfwstpwtfgggtklevk
Timeline for d1jhkl1: