Lineage for d1jhkh1 (1jhk H:2-113)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451404Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (32 PDB entries)
  8. 451413Domain d1jhkh1: 1jhk H:2-113 [66715]
    Other proteins in same PDB: d1jhkh2, d1jhkl1, d1jhkl2
    part of anti-estradiol Fab 57-2

Details for d1jhkh1

PDB Entry: 1jhk (more details), 2.51 Å

PDB Description: Crystal structure of the anti-estradiol antibody 57-2

SCOP Domain Sequences for d1jhkh1:

Sequence, based on SEQRES records: (download)

>d1jhkh1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4}
iqlvqsgpelkkpgetvrisckasdysfmtsgmqwvqqmpgkglkwigwlntqsgvpeya
edfkgrfafsletsattaylqinnlknedtatyfcatwggnsaywgqgttltvss

Sequence, based on observed residues (ATOM records): (download)

>d1jhkh1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4}
iqlvqsgpelkkpgetvrisckasdytsgmqwvqqmpgkglkwigwlntqsgvpeyaedf
kgrfafslettaylqinnlknedtatyfcatwggnsaywgqgttltvss

SCOP Domain Coordinates for d1jhkh1:

Click to download the PDB-style file with coordinates for d1jhkh1.
(The format of our PDB-style files is described here.)

Timeline for d1jhkh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jhkh2