Lineage for d1jhkh1 (1jhk H:2-113)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102070Species Anti-estradiol Fab 57-2, (mouse), kappa L chain [69137] (2 PDB entries)
  8. 102073Domain d1jhkh1: 1jhk H:2-113 [66715]
    Other proteins in same PDB: d1jhkh2, d1jhkl2

Details for d1jhkh1

PDB Entry: 1jhk (more details), 2.51 Å

PDB Description: Crystal structure of the anti-estradiol antibody 57-2

SCOP Domain Sequences for d1jhkh1:

Sequence, based on SEQRES records: (download)

>d1jhkh1 b.1.1.1 (H:2-113) Immunoglobulin (variable domains of L and H chains) {Anti-estradiol Fab 57-2, (mouse), kappa L chain}
iqlvqsgpelkkpgetvrisckasdysfmtsgmqwvqqmpgkglkwigwlntqsgvpeya
edfkgrfafsletsattaylqinnlknedtatyfcatwggnsaywgqgttltvss

Sequence, based on observed residues (ATOM records): (download)

>d1jhkh1 b.1.1.1 (H:2-113) Immunoglobulin (variable domains of L and H chains) {Anti-estradiol Fab 57-2, (mouse), kappa L chain}
iqlvqsgpelkkpgetvrisckasdytsgmqwvqqmpgkglkwigwlntqsgvpeyaedf
kgrfafslettaylqinnlknedtatyfcatwggnsaywgqgttltvss

SCOP Domain Coordinates for d1jhkh1:

Click to download the PDB-style file with coordinates for d1jhkh1.
(The format of our PDB-style files is described here.)

Timeline for d1jhkh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jhkh2