SCOP 1.59: Domain d1jhkh1: 1jhk H:2-113

Lineage for d1jhkh1 (1jhk H:2-113)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Anti-estradiol Fab 57-2, (mouse), kappa L chain [69137] (2 PDB entries)

8. Domain d1jhkh1: 1jhk H:2-113 [66715]
   Other proteins in same PDB: d1jhkh2, d1jhkl2

Details for d1jhkh1

PDB Entry: 1jhk, 2.51 Å

PDB Description: Crystal structure of the anti-estradiol antibody 57-2

SCOP Domain Sequences for d1jhkh1:

Sequence, based on SEQRES records:

>d1jhkh1 b.1.1.1 (H:2-113) Immunoglobulin (variable domains of L and H chains) {Anti-estradiol Fab 57-2, (mouse), kappa L chain}
iqlvqsgpelkkpgetvrisckasdysfmtsgmqwvqqmpgkglkwigwlntqsgvpeya
edfkgrfafsletsattaylqinnlknedtatyfcatwggnsaywgqgttltvss

Sequence, based on observed residues (ATOM records):

>d1jhkh1 b.1.1.1 (H:2-113) Immunoglobulin (variable domains of L and H chains) {Anti-estradiol Fab 57-2, (mouse), kappa L chain}
iqlvqsgpelkkpgetvrisckasdytsgmqwvqqmpgkglkwigwlntqsgvpeyaedf
kgrfafslettaylqinnlknedtatyfcatwggnsaywgqgttltvss

Timeline for d1jhkh1:

• d1jhkh1 is new in SCOP 1.59
  
• d1jhkh1 appears in SCOP 1.61
  
• d1jhkh1 appears in the current release, SCOPe 2.08