Lineage for d1jhda2 (1jhd A:174-396)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 178484Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
  4. 178485Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 178615Family c.26.1.5: ATP sulfurylase central domain [63979] (1 protein)
  6. 178616Protein ATP sulfurylase central domain [63980] (3 species)
  7. 178632Species unnamed symbiont of Riftia pachyptila [69455] (1 PDB entry)
  8. 178633Domain d1jhda2: 1jhd A:174-396 [66713]
    Other proteins in same PDB: d1jhda1

Details for d1jhda2

PDB Entry: 1jhd (more details), 1.7 Å

PDB Description: Crystal Structure of Bacterial ATP Sulfurylase from the Riftia pachyptila Symbiont

SCOP Domain Sequences for d1jhda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jhda2 c.26.1.5 (A:174-396) ATP sulfurylase central domain {unnamed symbiont of Riftia pachyptila}
pdtfrtaveirneikehgwskvvafqtrnpmhraheelcrmamesldadgvvvhmllgkl
kkgdipapvrdaairtmaevyfppntvmvtgygfdmlyagpreavlhayfrqnmgathfi
igrdhagvgdyygafdaqtifddevpegameieifradhtayskklnkivmmrdvpdhtk
edfvllsgtkvremlgqgiapppefsrpevakilmdyyqsins

SCOP Domain Coordinates for d1jhda2:

Click to download the PDB-style file with coordinates for d1jhda2.
(The format of our PDB-style files is described here.)

Timeline for d1jhda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jhda1