Lineage for d1jhda1 (1jhd A:1-173)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 232326Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 232327Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 232418Family b.58.1.2: ATP sulfurylase N-terminal domain [63801] (1 protein)
    incomplete barrel of 6 strands, the last PK strand is missing
  6. 232419Protein ATP sulfurylase N-terminal domain [63802] (3 species)
  7. 232438Species unnamed symbiont of Riftia pachyptila [69296] (1 PDB entry)
  8. 232439Domain d1jhda1: 1jhd A:1-173 [66712]
    Other proteins in same PDB: d1jhda2
    complexed with br, so4

Details for d1jhda1

PDB Entry: 1jhd (more details), 1.7 Å

PDB Description: Crystal Structure of Bacterial ATP Sulfurylase from the Riftia pachyptila Symbiont

SCOP Domain Sequences for d1jhda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jhda1 b.58.1.2 (A:1-173) ATP sulfurylase N-terminal domain {unnamed symbiont of Riftia pachyptila}
mikpvgsdelkplfvydpeehhklsheaeslpsvvissqaagnavmmgagyfsplqgfmn
vadamgaaekmtlsdgsffpvpvlcllentdaigdakrialrdpnvegnpvlavmdieai
eevsdeqmavmtdkvyrttdmdhigvktfnsqgrvavsgpiqvlnfsyfqadf

SCOP Domain Coordinates for d1jhda1:

Click to download the PDB-style file with coordinates for d1jhda1.
(The format of our PDB-style files is described here.)

Timeline for d1jhda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jhda2