SCOP 1.63: Domain d1jhda1: 1jhd A:1-173

Lineage for d1jhda1 (1jhd A:1-173)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
   barrel, closed; n=7, S=10; complex topology

4. Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families)

5. Family b.58.1.2: ATP sulfurylase N-terminal domain [63801] (1 protein)
   incomplete barrel of 6 strands, the last PK strand is missing

6. Protein ATP sulfurylase N-terminal domain [63802] (3 species)

7. Species unnamed symbiont of Riftia pachyptila [69296] (1 PDB entry)

8. Domain d1jhda1: 1jhd A:1-173 [66712]
   Other proteins in same PDB: d1jhda2
   complexed with br, so4

Details for d1jhda1

PDB Entry: 1jhd, 1.7 Å

PDB Description: Crystal Structure of Bacterial ATP Sulfurylase from the Riftia pachyptila Symbiont

SCOP Domain Sequences for d1jhda1:

Sequence; same for both SEQRES and ATOM records:

>d1jhda1 b.58.1.2 (A:1-173) ATP sulfurylase N-terminal domain {unnamed symbiont of Riftia pachyptila}
mikpvgsdelkplfvydpeehhklsheaeslpsvvissqaagnavmmgagyfsplqgfmn
vadamgaaekmtlsdgsffpvpvlcllentdaigdakrialrdpnvegnpvlavmdieai
eevsdeqmavmtdkvyrttdmdhigvktfnsqgrvavsgpiqvlnfsyfqadf

Timeline for d1jhda1:

• d1jhda1 first appeared in SCOP 1.59
  
• d1jhda1 appears in SCOP 1.61
  
• d1jhda1 appears in SCOP 1.65
  
• d1jhda1 appears in the current release, SCOPe 2.07