Class b: All beta proteins [48724] (180 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (15 families) |
Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein) contains extra structures; some similarity to the PK beta-barrel domain automatically mapped to Pfam PF14306 |
Protein ATP sulfurylase N-terminal domain [63802] (5 species) |
Species Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId:35843] [69296] (1 PDB entry) |
Domain d1jhda1: 1jhd A:1-173 [66712] Other proteins in same PDB: d1jhda2 complexed with br, so4 |
PDB Entry: 1jhd (more details), 1.7 Å
SCOPe Domain Sequences for d1jhda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jhda1 b.122.1.3 (A:1-173) ATP sulfurylase N-terminal domain {Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId: 35843]} mikpvgsdelkplfvydpeehhklsheaeslpsvvissqaagnavmmgagyfsplqgfmn vadamgaaekmtlsdgsffpvpvlcllentdaigdakrialrdpnvegnpvlavmdieai eevsdeqmavmtdkvyrttdmdhigvktfnsqgrvavsgpiqvlnfsyfqadf
Timeline for d1jhda1: