SCOP 1.65: Domain d1jgvl1: 1jgv L:1-107

Lineage for d1jgvl1 (1jgv L:1-107)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (98 PDB entries)

8. Domain d1jgvl1: 1jgv L:1-107 [66694]
   Other proteins in same PDB: d1jgvh1, d1jgvh2, d1jgvl2
   part of catalytic Fab 1D4

Details for d1jgvl1

PDB Entry: 1jgv, 1.85 Å

PDB Description: structural basis for disfavored elimination reaction in catalytic antibody 1d4

SCOP Domain Sequences for d1jgvl1:

Sequence; same for both SEQRES and ATOM records:

>d1jgvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
evvmtqsplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvppltfgagtklelk

Timeline for d1jgvl1:

• d1jgvl1 first appeared in SCOP 1.59
  
• d1jgvl1 appears in SCOP 1.63
  
• d1jgvl1 appears in SCOP 1.67
  
• d1jgvl1 appears in the current release, SCOPe 2.08