Lineage for d1jgvh2 (1jgv H:114-213)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221138Species Catalytic Fab 1D4, (mouse), kappa L chain [69152] (2 PDB entries)
  8. 221141Domain d1jgvh2: 1jgv H:114-213 [66693]
    Other proteins in same PDB: d1jgvh1, d1jgvl1

Details for d1jgvh2

PDB Entry: 1jgv (more details), 1.85 Å

PDB Description: structural basis for disfavored elimination reaction in catalytic antibody 1d4

SCOP Domain Sequences for d1jgvh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgvh2 b.1.1.2 (H:114-213) Immunoglobulin (constant domains of L and H chains) {Catalytic Fab 1D4, (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOP Domain Coordinates for d1jgvh2:

Click to download the PDB-style file with coordinates for d1jgvh2.
(The format of our PDB-style files is described here.)

Timeline for d1jgvh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jgvh1