| Class b: All beta proteins [48724] (149 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries) |
| Domain d1jgul2: 1jgu L:108-214 [66691] Other proteins in same PDB: d1jguh1, d1jguh2, d1jgul1 part of catalytic Fab 1D4 complexed with hbc, oh |
PDB Entry: 1jgu (more details), 1.8 Å
SCOP Domain Sequences for d1jgul2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jgul2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1jgul2: