Lineage for d1jguh2 (1jgu H:114-212)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221138Species Catalytic Fab 1D4, (mouse), kappa L chain [69152] (2 PDB entries)
  8. 221139Domain d1jguh2: 1jgu H:114-212 [66689]
    Other proteins in same PDB: d1jguh1, d1jgul1
    complexed with hbc, oh

Details for d1jguh2

PDB Entry: 1jgu (more details), 1.8 Å

PDB Description: structural basis for disfavored elimination reaction in catalytic antibody 1d4
PDB Compounds: (H:)

SCOP Domain Sequences for d1jguh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jguh2 b.1.1.2 (H:114-212) Immunoglobulin (constant domains of L and H chains) {Catalytic Fab 1D4, (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep

SCOP Domain Coordinates for d1jguh2:

Click to download the PDB-style file with coordinates for d1jguh2.
(The format of our PDB-style files is described here.)

Timeline for d1jguh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jguh1