Lineage for d1jguh1 (1jgu H:1-113)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1287970Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (14 PDB entries)
    Uniprot P18527 # HV56_MOUSE Ig heavy chain V region 914; 90% sequence identity
  8. 1287971Domain d1jguh1: 1jgu H:1-113 [66688]
    Other proteins in same PDB: d1jguh2, d1jgul1, d1jgul2
    part of catalytic Fab 1D4
    complexed with hbc, oh

Details for d1jguh1

PDB Entry: 1jgu (more details), 1.8 Å

PDB Description: structural basis for disfavored elimination reaction in catalytic antibody 1d4
PDB Compounds: (H:) antibody heavy chain

SCOPe Domain Sequences for d1jguh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jguh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]}
evklvesrgglvkpggslqlscaasgftfsgyamswfrltpekrlewvasiyngfrihyl
dsvkgrftissdyarnilylqmstlrsedtamyycsrgdaysryfdvwgagttvtvsa

SCOPe Domain Coordinates for d1jguh1:

Click to download the PDB-style file with coordinates for d1jguh1.
(The format of our PDB-style files is described here.)

Timeline for d1jguh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jguh2