Lineage for d1jgll2 (1jgl L:108-213)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453918Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 454044Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)
  8. 454125Domain d1jgll2: 1jgl L:108-213 [66682]
    Other proteins in same PDB: d1jglh1, d1jglh2, d1jgll1
    part of anti-estradiol Fab 57-2

Details for d1jgll2

PDB Entry: 1jgl (more details), 2.15 Å

PDB Description: Crystal structure of immunoglobulin Fab fragment complexed with 17-beta-estradiol

SCOP Domain Sequences for d1jgll2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgll2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOP Domain Coordinates for d1jgll2:

Click to download the PDB-style file with coordinates for d1jgll2.
(The format of our PDB-style files is described here.)

Timeline for d1jgll2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jgll1