SCOP 1.63: Domain d1jglh2: 1jgl H:114-213

Lineage for d1jglh2 (1jgl H:114-213)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Anti-estradiol Fab 57-2, (mouse), kappa L chain [69149] (2 PDB entries)

8. Domain d1jglh2: 1jgl H:114-213 [66680]
   Other proteins in same PDB: d1jglh1, d1jgll1
   complexed with est

Details for d1jglh2

PDB Entry: 1jgl, 2.15 Å

PDB Description: Crystal structure of immunoglobulin Fab fragment complexed with 17-beta-estradiol

SCOP Domain Sequences for d1jglh2:

Sequence, based on SEQRES records:

>d1jglh2 b.1.1.2 (H:114-213) Immunoglobulin (constant domains of L and H chains) {Anti-estradiol Fab 57-2, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records):

>d1jglh2 b.1.1.2 (H:114-213) Immunoglobulin (constant domains of L and H chains) {Anti-estradiol Fab 57-2, (mouse), kappa L chain}
akttppsvyplapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Timeline for d1jglh2:

• d1jglh2 first appeared in SCOP 1.59
  
• d1jglh2 appears in SCOP 1.61
  
• d1jglh2 appears in SCOP 1.65
  
• d1jglh2 appears in the current release, SCOPe 2.08