SCOPe 2.07: Domain d1jglh1: 1jgl H:1-113

Lineage for d1jglh1 (1jgl H:1-113)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (34 PDB entries)
   Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity ! Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10

8. Domain d1jglh1: 1jgl H:1-113 [66679]
   Other proteins in same PDB: d1jglh2, d1jgll1, d1jgll2
   part of anti-estradiol Fab 57-2
   complexed with est

Details for d1jglh1

PDB Entry: 1jgl, 2.15 Å

PDB Description: Crystal structure of immunoglobulin Fab fragment complexed with 17-beta-estradiol

PDB Compounds: (H:) Ig gamma-1-chain

SCOPe Domain Sequences for d1jglh1:

Sequence, based on SEQRES records:

>d1jglh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
qiqlvqsgpelkkpgetvrisckasdysfmtsgmqwvqqmpgkglkwigwlntqsgvpey
aedfkgrfafsletsattaylqinnlknedtatyfcatwggnsaywgqgttltvss

Sequence, based on observed residues (ATOM records):

>d1jglh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
qiqlvqsgpelkkpgetvrisckasdymtsgmqwvqqmpgkglkwigwlntqsgvpeyae
dfkgrfafslettaylqinnlknedtatyfcatwggnsaywgqgttltvss

Timeline for d1jglh1:

• d1jglh1 first appeared in SCOP 1.59
  
• d1jglh1 appears in SCOPe 2.06
  
• d1jglh1 appears in the current release, SCOPe 2.08