Lineage for d1jglh1 (1jgl H:1-113)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363225Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (29 PDB entries)
  8. 363231Domain d1jglh1: 1jgl H:1-113 [66679]
    Other proteins in same PDB: d1jglh2, d1jgll1, d1jgll2
    part of anti-estradiol Fab 57-2
    complexed with est

Details for d1jglh1

PDB Entry: 1jgl (more details), 2.15 Å

PDB Description: Crystal structure of immunoglobulin Fab fragment complexed with 17-beta-estradiol

SCOP Domain Sequences for d1jglh1:

Sequence, based on SEQRES records: (download)

>d1jglh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4}
qiqlvqsgpelkkpgetvrisckasdysfmtsgmqwvqqmpgkglkwigwlntqsgvpey
aedfkgrfafsletsattaylqinnlknedtatyfcatwggnsaywgqgttltvss

Sequence, based on observed residues (ATOM records): (download)

>d1jglh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4}
qiqlvqsgpelkkpgetvrisckasdymtsgmqwvqqmpgkglkwigwlntqsgvpeyae
dfkgrfafslettaylqinnlknedtatyfcatwggnsaywgqgttltvss

SCOP Domain Coordinates for d1jglh1:

Click to download the PDB-style file with coordinates for d1jglh1.
(The format of our PDB-style files is described here.)

Timeline for d1jglh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jglh2