Lineage for d1jglh1 (1jgl H:1-113)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102070Species Anti-estradiol Fab 57-2, (mouse), kappa L chain [69137] (2 PDB entries)
  8. 102071Domain d1jglh1: 1jgl H:1-113 [66679]
    Other proteins in same PDB: d1jglh2, d1jgll2

Details for d1jglh1

PDB Entry: 1jgl (more details), 2.15 Å

PDB Description: Crystal structure of immunoglobulin Fab fragment complexed with 17-beta-estradiol

SCOP Domain Sequences for d1jglh1:

Sequence, based on SEQRES records: (download)

>d1jglh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-estradiol Fab 57-2, (mouse), kappa L chain}
qiqlvqsgpelkkpgetvrisckasdysfmtsgmqwvqqmpgkglkwigwlntqsgvpey
aedfkgrfafsletsattaylqinnlknedtatyfcatwggnsaywgqgttltvss

Sequence, based on observed residues (ATOM records): (download)

>d1jglh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-estradiol Fab 57-2, (mouse), kappa L chain}
qiqlvqsgpelkkpgetvrisckasdymtsgmqwvqqmpgkglkwigwlntqsgvpeyae
dfkgrfafslettaylqinnlknedtatyfcatwggnsaywgqgttltvss

SCOP Domain Coordinates for d1jglh1:

Click to download the PDB-style file with coordinates for d1jglh1.
(The format of our PDB-style files is described here.)

Timeline for d1jglh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jglh2