SCOP 1.73: Domain d1jgcb_: 1jgc B:

Lineage for d1jgcb_ (1jgc B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.25: Ferritin-like [47239] (4 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (5 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (9 proteins)

6. Protein Bacterioferritin (cytochrome b1) [47244] (4 species)
   binds heme between two subunits; 24-mer

7. Species Rhodobacter capsulatus [TaxId:1061] [69004] (1 PDB entry)

8. Domain d1jgcb_: 1jgc B: [66674]

Details for d1jgcb_

PDB Entry: 1jgc, 2.6 Å

PDB Description: The 2.6 A Structure Resolution of Rhodobacter capsulatus Bacterioferritin with Metal-free Dinuclear Site and Heme Iron in a Crystallographic Special Position

PDB Compounds: (B:) bacterioferritin

SCOP Domain Sequences for d1jgcb_:

Sequence; same for both SEQRES and ATOM records:

>d1jgcb_ a.25.1.1 (B:) Bacterioferritin (cytochrome b1) {Rhodobacter capsulatus [TaxId: 1061]}
mkgdakvieflnaalrseltaisqywvhfrlqedwglakmakksreesieemghadkiia
rilfleghpnlqkldplrigegpretlecdlagehdalklyreardycaevgdivsknif
eslitdeeghvdfletqislydrlgpqgfallnaapmdaa

Timeline for d1jgcb_:

• d1jgcb_ first appeared in SCOP 1.59
  
• d1jgcb_ appears in SCOP 1.71
  
• d1jgcb_ appears in SCOP 1.75
  
• d1jgcb_ appears in the current release, SCOPe 2.08