SCOPe 2.06: Domain d1jfzb1: 1jfz B:200-347

Lineage for d1jfzb1 (1jfz B:200-347)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.149: RNase III domain-like [69064] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.149.1: RNase III domain-like [69065] (3 families)

5. Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
   Pfam PF00636

6. Protein RNase III endonuclease catalytic domain [69067] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries)

8. Domain d1jfzb1: 1jfz B:200-347 [66656]
   Other proteins in same PDB: d1jfzb2, d1jfzc2
   protein/RNA complex; complexed with mn

Details for d1jfzb1

PDB Entry: 1jfz, 2.1 Å

PDB Description: Crystal Structure of MN(II)-Complex of RNAse III Endonuclease Domain from Aquifex Aeolicus at 2.10 Angstrom Resolution

PDB Compounds: (B:) Ribonuclease III

SCOPe Domain Sequences for d1jfzb1:

Sequence; same for both SEQRES and ATOM records:

>d1jfzb1 a.149.1.1 (B:200-347) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]}
gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
sgrdanftrelfyklfkedilsaikegr

Timeline for d1jfzb1:

• d1jfzb1 first appeared in SCOP 1.59, called d1jfzb_
  
• d1jfzb1 was called d1jfzb_ in SCOPe 2.05
  
• d1jfzb1 appears in SCOPe 2.07
  
• d1jfzb1 appears in the current release, SCOPe 2.08