SCOPe 2.05: Domain d1jfta2: 1jft A:59-341

Lineage for d1jfta2 (1jft A:59-341)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)

6. Protein Purine repressor (PurR), C-terminal domain [53835] (1 species)

7. Species Escherichia coli [TaxId:562] [53836] (24 PDB entries)

8. Domain d1jfta2: 1jft A:59-341 [66653]
   Other proteins in same PDB: d1jfta1
   protein/DNA complex; complexed with hpa, po4; mutant

Details for d1jfta2

PDB Entry: 1jft, 2.5 Å

PDB Description: purine repressor mutant-hypoxanthine-purf operator complex

PDB Compounds: (A:) purine nucleotide synthesis repressor

SCOPe Domain Sequences for d1jfta2:

Sequence; same for both SEQRES and ATOM records:

>d1jfta2 c.93.1.1 (A:59-341) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]}
tksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdg
llvmcseypepllamleeyrhipmvvmdageakadftdavidnafeggymagryliergh
reigvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqph
rptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslg
etafnmlldrivnkreepqsievhprlierrsvadgpfrdyrr

Timeline for d1jfta2:

• d1jfta2 first appeared in SCOP 1.59
  
• d1jfta2 appears in SCOPe 2.04
  
• d1jfta2 appears in SCOPe 2.06
  
• d1jfta2 appears in the current release, SCOPe 2.08