SCOP 1.69: Domain d1jfqh2: 1jfq H:422-521

Lineage for d1jfqh2 (1jfq H:422-521)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)

8. Domain d1jfqh2: 1jfq H:422-521 [66647]
   Other proteins in same PDB: d1jfqh1, d1jfql1, d1jfql2
   part of Fab 36-71

Details for d1jfqh2

PDB Entry: 1jfq, 1.9 Å

PDB Description: antigen-binding fragment of the murine anti-phenylarsonate antibody 36-71, "fab 36-71"

SCOP Domain Sequences for d1jfqh2:

Sequence; same for both SEQRES and ATOM records:

>d1jfqh2 b.1.1.2 (H:422-521) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
agttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr

Timeline for d1jfqh2:

• d1jfqh2 first appeared in SCOP 1.59
  
• d1jfqh2 appears in SCOP 1.67
  
• d1jfqh2 appears in SCOP 1.71
  
• d1jfqh2 appears in the current release, SCOPe 2.08