SCOP 1.63: Domain d1jfpa_: 1jfp A:

Lineage for d1jfpa_ (1jfp A:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (2 families)

5. Family f.13.1.2: Rhodopsin-like [81320] (1 protein)
   Individual TM segments have a number of kinks and distortions

6. Protein Rhodopsin [56876] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56877] (5 PDB entries)

8. Domain d1jfpa_: 1jfp A: [66645]
   dark adapted
   complexed with ret

Details for d1jfpa_

PDB Entry: 1jfp

PDB Description: structure of bovine rhodopsin (dark adapted)

SCOP Domain Sequences for d1jfpa_:

Sequence; same for both SEQRES and ATOM records:

>d1jfpa_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus)}
laaymfllimlgfpinfltlyvtvqhkklrtplnyillnlavadlfmvfggftttlytsl
hgyfvfgptgcnlegffatlggeialwslvvlaieryvvvckpmsnfrfgenhaimgvaf
twvmalacaapplvgwsryipegmqcscgidyytpheetnnesfviymfvvhfiiplivi
ffcygqlvftvkeaaaqqqesattqkaekevtrmviimviaflicwlpyagvafyifthq
gsdfgpifmtipaffaktsavynpviyimmnkqfrncmvttlccgknplgddeasttvsk
tetsqvapa

Timeline for d1jfpa_:

• d1jfpa_ first appeared in SCOP 1.59
  
• d1jfpa_ appears in SCOP 1.61
  
• d1jfpa_ appears in SCOP 1.65
  
• d1jfpa_ appears in the current release, SCOPe 2.08