Lineage for d1jfpa_ (1jfp A:)
- Root: SCOP 1.61
Class f: Membrane and cell surface proteins and peptides [56835] (12 folds) 
Fold f.2: Membrane all-alpha [56868] (1 superfamily) Superfamily f.2.1: Membrane all-alpha [56869] (13 families) 
Family f.2.1.1: Seven-helix membrane receptors [56870] (4 proteins) 
Protein Rhodopsin [56876] (1 species) Species Cow (Bos taurus) [TaxId:9913] [56877] (5 PDB entries) 
Domain d1jfpa_: 1jfp A: [66645]
Details for d1jfpa_
PDB Entry: 1jfp (more details)
PDB Description: structure of bovine rhodopsin (dark adapted)
SCOP Domain Sequences for d1jfpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jfpa_ f.2.1.1 (A:) Rhodopsin {Cow (Bos taurus)}
laaymfllimlgfpinfltlyvtvqhkklrtplnyillnlavadlfmvfggftttlytsl
hgyfvfgptgcnlegffatlggeialwslvvlaieryvvvckpmsnfrfgenhaimgvaf
twvmalacaapplvgwsryipegmqcscgidyytpheetnnesfviymfvvhfiiplivi
ffcygqlvftvkeaaaqqqesattqkaekevtrmviimviaflicwlpyagvafyifthq
gsdfgpifmtipaffaktsavynpviyimmnkqfrncmvttlccgknplgddeasttvsk
tetsqvapa
SCOP Domain Coordinates for d1jfpa_:
Click to download the PDB-style file with coordinates for d1jfpa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jfpa_:
- d1jfpa_ first appeared in SCOP 1.59
- d1jfpa_ appears in SCOP 1.63
- d1jfpa_ appears in the current release, SCOPe 2.08
View in 3D