Lineage for d1jfpa_ (1jfp A:)

  1. Root: SCOP 1.59
  2. 141686Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 141752Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 141753Superfamily f.2.1: Membrane all-alpha [56869] (11 families) (S)
  5. 141754Family f.2.1.1: Seven-helix membrane receptors [56870] (4 proteins)
  6. 141794Protein Rhodopsin [56876] (1 species)
  7. 141795Species Cow (Bos taurus) [TaxId:9913] [56877] (3 PDB entries)
  8. 141800Domain d1jfpa_: 1jfp A: [66645]

Details for d1jfpa_

PDB Entry: 1jfp (more details)

PDB Description: Structure of bovine rhodopsin (dark adapted)

SCOP Domain Sequences for d1jfpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfpa_ f.2.1.1 (A:) Rhodopsin {Cow (Bos taurus)}
laaymfllimlgfpinfltlyvtvqhkklrtplnyillnlavadlfmvfggftttlytsl
hgyfvfgptgcnlegffatlggeialwslvvlaieryvvvckpmsnfrfgenhaimgvaf
twvmalacaapplvgwsryipegmqcscgidyytpheetnnesfviymfvvhfiiplivi
ffcygqlvftvkeaaaqqqesattqkaekevtrmviimviaflicwlpyagvafyifthq
gsdfgpifmtipaffaktsavynpviyimmnkqfrncmvttlccgknplgddeasttvsk
tetsqvapa

SCOP Domain Coordinates for d1jfpa_:

Click to download the PDB-style file with coordinates for d1jfpa_.
(The format of our PDB-style files is described here.)

Timeline for d1jfpa_: