Lineage for d1jfme_ (1jfm E:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406827Protein NK cell ligand RAE-1 beta [69683] (1 species)
  7. 1406828Species Mouse (Mus musculus) [TaxId:10090] [69684] (3 PDB entries)
  8. 1406835Domain d1jfme_: 1jfm E: [66644]

Details for d1jfme_

PDB Entry: 1jfm (more details), 2.85 Å

PDB Description: crystal structure of murine nk cell ligand rae-1 beta
PDB Compounds: (E:) retinoic acid early transcript beta

SCOPe Domain Sequences for d1jfme_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfme_ d.19.1.1 (E:) NK cell ligand RAE-1 beta {Mouse (Mus musculus) [TaxId: 10090]}
dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc
ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff
tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek

SCOPe Domain Coordinates for d1jfme_:

Click to download the PDB-style file with coordinates for d1jfme_.
(The format of our PDB-style files is described here.)

Timeline for d1jfme_: